PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_58950.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family NAC
Protein Properties Length: 335aa    MW: 36795.7 Da    PI: 6.0997
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_58950.3genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM169.79.4e-5361341128
           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                   lppGfrFhPtd+elv +yLk++v++ k+el evi+ +d+yk+ePw+Lp k  + +++ ew+fF++rd+ky++g+r+nrat++gyWkatgkd++v + 
  MLOC_58950.3   6 LPPGFRFHPTDDELVGYYLKRRVDNLKIEL-EVIPVIDLYKCEPWELPeKsFLPKRDLEWFFFVPRDRKYPNGSRTNRATTTGYWKATGKDRKVSCD 101
                   79****************************.99**************95334445667*************************************** PP

           NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                   +g++ g++ktLvfykgrap ge+tdWvmheyrl
  MLOC_58950.3 102 GGAVCGVRKTLVFYKGRAPGGERTDWVMHEYRL 134
                   *******************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.1E-603156IPR003441NAC domain
PROSITE profilePS5100557.0646157IPR003441NAC domain
PfamPF023652.4E-287134IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008283Biological Processcell proliferation
GO:0071365Biological Processcellular response to auxin stimulus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MGTMTLPPGF RFHPTDDELV GYYLKRRVDN LKIELEVIPV IDLYKCEPWE LPEKSFLPKR  60
DLEWFFFVPR DRKYPNGSRT NRATTTGYWK ATGKDRKVSC DGGAVCGVRK TLVFYKGRAP  120
GGERTDWVMH EYRLCQDLLH GASNFIGAYA LCRVIKRTEA GLLHGDAAAK AKPCHQQMTK  180
VGSSSSLVTT DQQLGSLTPS PPRLDIVGNA FQLHTSPSPL YGGEVVSGMG APLGFPQQDA  240
AATFFVDADL AGAGETTQSH MPFFGDMGVV SDHELRWDTL PPYANNTFST TAVAGAAELW  300
NPAAPNAAAP MLCREESDDL AAFFSSLDEN NMVVY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-51116012168NO APICAL MERISTEM PROTEIN
1ut4_B4e-51116012168NO APICAL MERISTEM PROTEIN
1ut7_A4e-51116012168NO APICAL MERISTEM PROTEIN
1ut7_B4e-51116012168NO APICAL MERISTEM PROTEIN
3swm_A4e-51116115172NAC domain-containing protein 19
3swm_B4e-51116115172NAC domain-containing protein 19
3swm_C4e-51116115172NAC domain-containing protein 19
3swm_D4e-51116115172NAC domain-containing protein 19
3swp_A4e-51116115172NAC domain-containing protein 19
3swp_B4e-51116115172NAC domain-containing protein 19
3swp_C4e-51116115172NAC domain-containing protein 19
3swp_D4e-51116115172NAC domain-containing protein 19
4dul_A4e-51116012168NAC domain-containing protein 19
4dul_B4e-51116012168NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00439DAPTransfer from AT4G17980Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3689850.0AK368985.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv2083F05.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010235019.21e-149PREDICTED: NAC domain-containing protein 72-like
SwissprotA4VCM02e-71NAC45_ARATH; NAC domain-containing protein 45
TrEMBLM0XCW70.0M0XCW7_HORVD; Uncharacterized protein
STRINGMLOC_58950.30.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62093854
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17980.11e-82NAC domain containing protein 71